1. Notes: 1 / 3 days ago 
    Looking for a good Kaze Tachinu download. Yep.

    Looking for a good Kaze Tachinu download. Yep.

     
  2. Notes: 1 / 3 days ago 

    The name “Akihabs” bothers me. A lot.

    Guys. Akihabara’s proper shortened name (or not really shortened because the name Akihabara was derived from it anyway) is Akiba. Seriously. Whenever somebody from the office mentions “Akihabs” I feel like someone’s scraping their nails on a blackboard right beside my ear.

    -_____-

  3. Notes: 4 / 3 days ago 

    Cartoon smut

    Sam: I can’t believe I’m about to say this but I hope you’re watching cartoon smut, because reading Dick Roman crap over and over again is just self-punishment.
    Dean: It’s called anime. And it’s an art form

    ~~~

    Thank you, Dean. :))

  4. 4 days ago 

    Gather ye rosebuds while ye may

    I’m trying, okay.

  5. Notes: 21383 / 5 days ago  from anditslove (originally from buzzfeed)
  6. Notes: 125150 / 5 days ago  from weshipdramione (originally from irrationalwitch-deactivated2014)

    actualpuppydelphine:

    irrationalwitch:

    sirius gets a baby girl and names her orange and he’s just so happy and proud and he tells everyone he meets hey this is orange, she’s the new black

    and when sirius dies she will be the orphan black

  7. 5 days ago 
    Lookie what I found at the bookstore today! A strawberry keyholder! And I’m using it to hold… my duplicate car keys keychain. Gotta keep the dragon shuriken protected. And separate from the house doors-related ankh keychain. Hmmmm. Maybe I should have bought the coffee bean keyholder for that one. :P

    Lookie what I found at the bookstore today! A strawberry keyholder! And I’m using it to hold… my duplicate car keys keychain. Gotta keep the dragon shuriken protected. And separate from the house doors-related ankh keychain. Hmmmm. Maybe I should have bought the coffee bean keyholder for that one. :P

     
  8. 1 week ago 

    Diet mode!

    Have to lose weight for Kristle’s wedding. Tsk. Can’t have me waddling my way around on her wedding day. :))

  9. 1 week ago 

    Am I the only one who thinks UE’s halftime performance is more appropriate for a dance competition than cheering?

    I mean, I enjoyed their sequence, but I think the songs and dance steps used were a bit too sexy for sports. Wiggle Wiggle and Talk Dirty?

    Or that’s just me? Maybe I’m a prude? Hahaha.

  10. Notes: 235033 / 2 weeks ago  from weshipdramione (originally from charlesxaviher)

    karenandthababes:

    colinmorgs:

    we all remember the first time we came across a smut fic

    (Source: charlesxaviher)

avatar_128
 
 
Hi.

Bye.
 
 

Following

clientsfromhelleatsleepdrawquoteskinegeek-studiolesbianedstephwinchesterblissbubbleslovegivesmehopeanditsloverandominternetgothiccharmschooliwroteapoemoncejustroyaishutl0wfysurfbeneathyourskinhitrecordjoelifehackableloveyourchaosrich-world-problemsofficialbookfaceweshipdramionestaffamymebbersonilovechartsmoviebarcodeannstreetstudioslaughterhouse90210yukariabepapertissueomgsexyfoodgallagherishvenndiagramsjustroyaiheadcanonssolidmusicmanilaicanreadprettyfoodsfygirlcrushpotatoesdopotatesweethomestylewriteoneleafthatsnotpunnyisaidnopeekingproofmathisbeautifulichiginsaltandfatboboykidblind-spotsfuckyeahnaomilyhappymonsterssketchymusingslacuisinepalabaseffystonemnowwcfoodiesforthesullenfuckyeahdessertkari-shmalizcarletticodeforlovewimpydrawingsartinmycoffeehogwarts-expressquotecompanyquote-bookvforvikoymusicforyourcoffeechaiistarbookshelfpornfuckyeahkateandleofuckyeahsubsforgeweasleylovequotebookfuckyeaheffyexergianfuckyeahcardcaptorsdomdycaicocaptchafailblackwisteriatedlrfyeahonetreehillohyeahfactsgangbadoywrdbnrpinoytumblrcontra1veritasfuckyeahcougartownimportantgoateneoweb-comicstarvoskidcastingsaturdayworldmychristmasfuck-yeah-hydefuckyeahamazingthechaoticlifeofjillfyeahstrangefindsjoserizalmyhalloweengoosegirlandninjalebensmusikreeseypeasynotpantsfuckyeahlukepasqualinothedailywhatblogsecretmugremakerfuckyeahhlovefuckyeahdressesbluemambaravenahawthornandvinefuckyeahclassicalletters-from-hogwartsslightlyamusingstuffmygirlfriendsaysprettytastymysterysongstumblrbotfuckyeahphelpstwinsfuckyeahfreffystrawberrypiggitheyahooanswersreadhardfully-bookedkieferravenareadingandthings1-rulemaniyowprettifynotjustcheersbeerietyomgskinsdailydropcaptumblaritycamehinflatablefishcatchowfancyfastfoodoverheardattheateneofueledbyphotosfuckyeahateneooptipessimismhiddencriesskinstflnfindyourselfwetterprettyspacefuckyeahconformitysimplemomentsfuckyeahkayascodelariodeliciosofmylifeitikmanwhytheyrehotmovieofthedayfuckyeahghosttownsfuckyeahfunnythingsfuckyeahmitchhewerfuckyeahprettyshoespitchbluelinusmotufuckyeahinceptionshipslindseymejiafuckyeahskinsandeonette02commonsxkcdexplainedomegle1fuckyeahgadgetsstoplookandthinkfuckyeaheffystonemfoodinreallifeyellowstarburstsmoothieadaythisiswhyyourefatjapanuaryguysssfuckyeahjoedempsieawesomeyoutubecomments
 

Tumblr